NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0167644_1000023

Scaffold Ga0167644_1000023


Overview

Basic Information
Taxon OID3300015206 Open in IMG/M
Scaffold IDGa0167644_1000023 Open in IMG/M
Source Dataset NameArctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river))
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Bristol
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)149931
Total Scaffold Genes148 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)96 (64.86%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location NameRussell glacier, Kangerlussuaq, Greenland
CoordinatesLat. (o)67.057002Long. (o)-50.459694Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001194Metagenome / Metatranscriptome750Y
F047241Metagenome / Metatranscriptome150Y
F056957Metagenome / Metatranscriptome137Y

Sequences

Protein IDFamilyRBSSequence
Ga0167644_1000023125F001194N/AMKMGRAALHALAGLGALIGYGCLLAFLCLVGMQAYRWFREGEWLHIGMGDGIRIGLVHCCVQGGGSGRLAEFLQWWGSPATWLGLHKVFEVIPASLALFAVSIVGNSLFNYCRDRLEQR*
Ga0167644_100002350F047241N/AMTDGKDNVHLLRALALSHDMLAAAEKANWQSLGRLDAERLELLKSFWLETQRADAADRALLEEISKINDRTIGLVEHQRRRKGRDIDMAAVGRRAVAAYSSIRLQR*
Ga0167644_100002353F056957AGGMASDGQPVQIPAINLVQGSQAPTAAAVQPSGKVLPPPGKPPAAPAATNVQAQVALLNKYLNDSGKPDQFRVDPSSDDKLIQQINPANGAVIGEFPVSEFAALARSVGISGVIVDQHA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.