NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0167644_1000252

Scaffold Ga0167644_1000252


Overview

Basic Information
Taxon OID3300015206 Open in IMG/M
Scaffold IDGa0167644_1000252 Open in IMG/M
Source Dataset NameArctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river))
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Bristol
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)58216
Total Scaffold Genes55 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)34 (61.82%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location NameRussell glacier, Kangerlussuaq, Greenland
CoordinatesLat. (o)67.057002Long. (o)-50.459694Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009625Metagenome / Metatranscriptome315Y
F011009Metagenome / Metatranscriptome296Y
F011312Metagenome / Metatranscriptome292Y

Sequences

Protein IDFamilyRBSSequence
Ga0167644_100025238F011009GGAGMNTLASKLTAFAAAMLVNGMIMSAVGYLFALQSHPHMSALSFARAVAAHQWFI*
Ga0167644_100025242F009625GGAGLALTSFELGKLKIIGHVREELDLAGIVAQSIRCISGGIETPPGIARLTIIVNGTSGTLDLKAHEVEDCESIVVGETWHKIAALIGRLAG*
Ga0167644_100025249F011312AGGAGMNTLSSKLAAFAAALAINGLVLGALGYLFALQSHPNMSAIAFAKAVVAHQWLG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.