 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300015265 Open in IMG/M |
| Scaffold ID | Ga0182005_1080568 Open in IMG/M |
| Source Dataset Name | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 899 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Sorghum-Associated Microbial Communities From Plants Grown In Nebraska, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Nebraska | |||||||
| Coordinates | Lat. (o) | 41.1613 | Long. (o) | -96.6752 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F099821 | Metagenome | 103 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0182005_10805682 | F099821 | AGGAGG | VPASTELSEAVLSQRRLIERLLVHGRRETGEEPSLRSPDARDAEFVKNLQIFLRLVVDADALHLRAGHGLTGDPAQAAAVNGRLEELRERITLPTDVPLTLELLLGRRFELERLLIELGDRTYLAGRLADVYDEQSGTVATWWSLYGDELPPLLPGGVTRRPEVAQPPGADEVEATRQRLARLMRVKESQAHMVKA |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |