Scaffold Ga0180009_10005723

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0180009_10005723

Scaffold Ga0180009_10005723

Overview

Basic Information
Taxon OID	3300015370 Open in IMG/M
Scaffold ID	Ga0180009_10005723 Open in IMG/M
Source Dataset Name	Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - OS_PC_MetaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	13242
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (83.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe

Source Dataset Sampling Location
Location Name	Sweden: Oskarshamn
Coordinates	Lat. (^o)	57.4344	Long. (^o)	16.66	Alt. (m)		Depth (m)	448
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047154	Metagenome	150	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180009_100057239	F047154	AGGAGG	MNYRCEEAKLSDAEIADIYRNMEARGMSFIFCQACSEEMKTEQARKSSTGLIMCRPCFMHNDTDATQDDIDQVLEEDFPGYLASFNQL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.