Basic Information | |
---|---|
Taxon OID | 3300015374 Open in IMG/M |
Scaffold ID | Ga0132255_100246926 Open in IMG/M |
Source Dataset Name | Col-0 rhizosphere combined assembly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2548 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere → Arabidopsis Rhizosphere Microbial Communities From The University Of North Carolina |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | University of North Carolina | |||||||
Coordinates | Lat. (o) | 35.9 | Long. (o) | -79.05 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F028613 | Metagenome | 191 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0132255_1002469263 | F028613 | GGA | VARCGAFPQNVELSFTGQGIDTEGGLNNAVFSACTNTTTGEVFDLHATDTYAQSGDQVFIEADSFVQAIDPANCTASTAHAVPFRVAGGTGGHAGATGQGRFNLYSNLTPCNGLTPPAFVSFEGVIQTPQ* |
⦗Top⦘ |