Scaffold Ga0181500_1540918

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0181500_1540918

Scaffold Ga0181500_1540918

Overview

Basic Information
Taxon OID	3300016728 Open in IMG/M
Scaffold ID	Ga0181500_1540918 Open in IMG/M
Source Dataset Name	Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	718
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location Name	USA: Michigan
Coordinates	Lat. (^o)	47.1149	Long. (^o)	-88.5476	Alt. (m)		Depth (m)	.1 to .2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033877	Metagenome / Metatranscriptome	176	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0181500_15409181	F033877	AGGA	VTGERLSQAGWLNPYKFAPQGAETGGRIHQFLWQRSHAASDAKQELSGKEQIETATEPSQVAQEGFGLE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.