Basic Information | |
---|---|
Taxon OID | 3300016887 Open in IMG/M |
Scaffold ID | Ga0186369_100816 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from North Atlantic Ocean in L1 medium with natural Eastern Pacific seawater, no silica (Eastern Pacific), 21 C, 35 psu salinity and 419 ?mol photons light - micromonas sp. RCC451 (MMETSP1400) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3863 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Atlantic Ocean | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F062730 | Metagenome / Metatranscriptome | 130 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186369_1008162 | F062730 | GAG | MCDTYNMGTETPVGYRLVRVGVRGRVPTLHTRAPEDLTTRQKYDLRYREKHRAKLLAYHREYYRKKRKLY |
⦗Top⦘ |