NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186234_113839

Scaffold Ga0186234_113839


Overview

Basic Information
Taxon OID3300017225 Open in IMG/M
Scaffold IDGa0186234_113839 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic communities from Sea of Japan in seawater with wheat grains, 20 C, 35 psu salinity and 681 ?mol photons light - Paramoeba aestuarina SoJaBio B1-5/56/2 (MMETSP0161_2)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)724
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NameSea of Japan
CoordinatesLat. (o)42.26722Long. (o)136.71861Alt. (m)Depth (m)3665
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040999Metagenome / Metatranscriptome160Y

Sequences

Protein IDFamilyRBSSequence
Ga0186234_1138392F040999N/AMAKPSVRILEHRVKFFDNRPDEVNDCRNDDTYKKWLKGKTAAATVVQGTSQQESITFKVEGADVKGLTRTNKTSKFYVPVNTESVKLGDFAVGEHTHTFDKQEIENIAAARANWSLTTTFHDESGNEFCKRESSFKIVGPQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.