Basic Information | |
---|---|
Taxon OID | 3300017255 Open in IMG/M |
Scaffold ID | Ga0186462_109824 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from English Channel in f/20 medium with seawater, no silicate, 18 C, 30 psu salinity and 314 ?mol photons light - Alexandrium tamarense CCMP 1771 (MMETSP0378) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 553 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Chrysophyceae → Chromulinales → Chromulinaceae → Spumella → Spumella elongata | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | English Channel | |||||||
Coordinates | Lat. (o) | 50.6 | Long. (o) | 4.25 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000631 | Metagenome / Metatranscriptome | 971 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186462_1098241 | F000631 | N/A | GNRLRVLRSGQEPDTACGKGFESLVKGXXXAVELWKHPYHTMDNATFEQEFQCWFASMCTTKCGGLPSQATARKADLTKKCQDVQVDWLKIWNMFSQDEVEWFKKTYPSEEVPEEEQSTVHYKQAMETAKEVSKKELLCLTLFTIDDECVKWPYIRLGN |
⦗Top⦘ |