NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186431_114562

Scaffold Ga0186431_114562


Overview

Basic Information
Taxon OID3300017265 Open in IMG/M
Scaffold IDGa0186431_114562 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic communities from Gulf of Mexico in f/2 medium with silicate, 20 C, 21 psu salinity and 315 ?mol photons light - Stephanopyxis turris CCMP 815 (MMETSP0794_2)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)739
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NameGulf of Mexico
CoordinatesLat. (o)29.4666Long. (o)-86.121Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051162Metagenome / Metatranscriptome144Y

Sequences

Protein IDFamilyRBSSequence
Ga0186431_1145621F051162N/AMPLVKIFARHSLSKHIPLPALQKSLCNIWGTKPNTTKLMLTRVEDWTDESFSEDCYVDIRAKGTPERTREAVLIGMKKVQEAFAEQDLIANIRLETYEGEGYFHVPPSS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.