Scaffold Ga0186043_1017706

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0186043_1017706

Scaffold Ga0186043_1017706

Overview

Basic Information
Taxon OID	3300017272 Open in IMG/M
Scaffold ID	Ga0186043_1017706 Open in IMG/M
Source Dataset Name	Metatranscriptome of marine host-associated eukaryotic communities from Pacific Ocean in f/2 medium w/o silicate, 25 C, 35 psu salinity and 713 ?mol photons light - Gambierdiscus australes CAWD 149 (MMETSP0766_2)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	National Center for Genome Resources
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1017
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location Name	Pacific Ocean
Coordinates	Lat. (^o)	35.0	Long. (^o)	173.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056219	Metatranscriptome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186043_10177061	F056219	N/A	MHIVQAFDAHWSRRNRPSTEWAGVGGGTLGRHRPCLCLPCNFLPPELGGQKVHVWCLLGLLIGFSVLCIGMFEATRLTTHVLRSPCTVLGSEVLDVGTCTLCDDSEPANCEVHPIATARLAVTFKPMHRNENITGWVWYCKGRAESDPCQPHIKFLDQLSLDMRHEFDHRYQIGGPIPCTSGQVYAYMQMHAMEGELRECYYSSRDLTGEDVWLSMPSPGLVDHAWFQKHLEYPVLLALGGLVLLSVLLGCLALEGAELWASGLV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.