Basic Information | |
---|---|
Taxon OID | 3300017299 Open in IMG/M |
Scaffold ID | Ga0186338_1027847 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from northern Puget Sound, Washington in Ciliate medium, 15 C, 30 psu salinity and 405 ?mol photons light - Strombidinopsis acuminata SPMC142 (MMETSP0126) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 675 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: northern Puget Sound Washington | |||||||
Coordinates | Lat. (o) | 48.608 | Long. (o) | -122.769 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F035313 | Metatranscriptome | 172 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186338_10278471 | F035313 | N/A | SGRPCPPAPPAPRSAAVPLAMALEVPSGYENGCGWDFDAKAAEKDGKMKKDDPIQEHYKKTGLFGSITGAFGDKKTMYCHHLTQSGEPAARAAKAAGKSFKSADEVWAFIGRPACCGRLAYDRASGNLKCGQVVKADHDNTCNEETCPFIASGLSCPTPAWALK |
⦗Top⦘ |