Basic Information | |
---|---|
Taxon OID | 3300017326 Open in IMG/M |
Scaffold ID | Ga0186493_115338 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Baffin Bay in L1 medium with seawater, 2 C, 33 psu salinity and 547 ?mol photons light - Polarella glacialis CCMP 2088 (MMETSP1440) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 760 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Ocean: Baffin Bay | |||||||
Coordinates | Lat. (o) | 78.5978 | Long. (o) | -74.4992 | Alt. (m) | Depth (m) | 6 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F018723 | Metagenome / Metatranscriptome | 233 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186493_1153381 | F018723 | AGG | MVAESKDKTQGQAAAKKGGKDKEPFIQQFELKDVFPHFCDRKTKLMPLNDVAYVLRAMGLTIYGSEEKLIKEQVEKVDGMGKPVTFQTVQNWVEEHRDTYVKSYGDAYSAVGTLCHEGIIGDKSAVIQVAQLRHLVSEVGDKIKAETVDKILKGGDMPGTNSIKGETCTLDEFLVFLQK |
⦗Top⦘ |