NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186695_1054985

Scaffold Ga0186695_1054985


Overview

Basic Information
Taxon OID3300017351 Open in IMG/M
Scaffold IDGa0186695_1054985 Open in IMG/M
Source Dataset NameMetatranscriptome of coastal eukaryotic communities from Gulf of Mexico in L1 medium, 22 C, 32 psu salinity and 304 ?mol photons light - Karenia brevis CCMP 2229 (MMETSP0031)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)512
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NameGulf of Mexico
CoordinatesLat. (o)27.0171Long. (o)-82.4763Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005002Metagenome / Metatranscriptome415Y

Sequences

Protein IDFamilyRBSSequence
Ga0186695_10549851F005002N/APALPALRQHFCNRFPALRSDRMAMKLLSTVLAMLLVSVAAYPVYSPDAGEDVDTCSGITCKTVECKPPFVWKSAKDVGTCCPVCFAESVKVPEDRSWTAGLSGGVGMNNNADSILCRGVMCPPLHCPEFEQIFDDRCCTKCKSAAATTPADLAK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.