 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300017362 Open in IMG/M |
| Scaffold ID | Ga0186693_1043327 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of coastal eukaryotic communities from Gulf of Mexico in L1 medium, 22 C, 32 psu salinity and 675 ?mol photons light - Scrippsiella trochoidea CCMP 3099 (MMETSP0271) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 827 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Gulf of Mexico | |||||||
| Coordinates | Lat. (o) | 27.3122 | Long. (o) | -82.601 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F087219 | Metatranscriptome | 110 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186693_10433271 | F087219 | N/A | AQCYKKNQYWANCKPSCDTAPDPNDGNKSWSCETVGPRGWGLALKGWPSLYCFSLYMPSGYEGGLLKAVLKANAGIFQCDGYDVFAAEPDTLGTSKDDIEVKAIQIPKISVGVSQDGTAGNAKLFMAVWDKVIAGGRFRNYDWTIKVDPDAVLVAWRIRDHMRPHVGQKVYVVNCNKFPGSPNFPMMYGAVEVFSQSAMVQYALNSWKCGKQLPWGSWGEDYYMTHCMDFIGVGRIGDFGILGDNMCTGANCADGGIASFHPFKNTGVWMQCWGQ |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |