Scaffold Ga0186696_1056385

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0186696_1056385

Scaffold Ga0186696_1056385

Overview

Basic Information
Taxon OID	3300017367 Open in IMG/M
Scaffold ID	Ga0186696_1056385 Open in IMG/M
Source Dataset Name	Metatranscriptome of coastal eukaryotic communities from Gulf of Mexico in L1 medium, 22 C, 32 psu salinity and 300 ?mol photons light - Karenia brevis CCMP 2229 (MMETSP0027)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	National Center for Genome Resources
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	556
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Peridiniales → Endodiniaceae → Brandtodinium → Brandtodinium nutricula	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location Name	Gulf of Mexico
Coordinates	Lat. (^o)	27.0171	Long. (^o)	-82.4763	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082720	Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186696_10563851	F082720	N/A	EGRLSVVSESQVHIDGVQRYLVQFSSGELSRADGVGFVFSPXXXXPRLPCAKNIQRIVSIFVNQRGRICMRVFADIVRASAFVKPLECGDWVEMCIDLDNRMATFNVWPNTSNGWPPVTGTPSSTAEFPFGNKLTKLNQAGAKPVKLNVGHLACVVKNTGVTVTLGS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.