Scaffold Ga0186081_1026481

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0186081_1026481

Scaffold Ga0186081_1026481

Overview

Basic Information
Taxon OID	3300017377 Open in IMG/M
Scaffold ID	Ga0186081_1026481 Open in IMG/M
Source Dataset Name	Metatranscriptome of marine eukaryotic communities from unknown location in L1 medium, low P, at 24 C, 32 psu salinity and 234 ?mol photons light - Alexandrium monilatum CCMP 3105 (MMETSP0096)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	National Center for Genome Resources
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	976
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056219	Metatranscriptome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186081_10264811	F056219	GAGG	MHIGQALDLHWSRRARPTPTGAGVGSVSLRNRTCFCLPCALLNPDLGGQKVHVWCLLGALVGFSVICIGLFEATRLTTHVLRSPCTVVGSEVLDVGTCTLCDDNTPANCEVHPIATARLAVTFKPMHMNNNVTGWVWYCKGRAESDPCQQHVKFLDQLSLDMRERFNQRFQMGGPIPCTTGQVFAYMQMHAAEGGTRECYYSSRDPNGEDVWLSMPSPGLVDHAWFQKHLEYPVLLALGGLVLLSVLLGCLALEGAELWASGLV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.