Scaffold Ga0186481_1039832

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0186481_1039832

Scaffold Ga0186481_1039832

Overview

Basic Information
Taxon OID	3300017382 Open in IMG/M
Scaffold ID	Ga0186481_1039832 Open in IMG/M
Source Dataset Name	Metatranscriptome of marine eukaryotic communities from Baltic Sea in f/2 medium with sea water w/o silica, 3 C, 3 psu salinity and 693 ?mol photons light - Scrippsiella Hangoei SHTV-5 (MMETSP0360)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	National Center for Genome Resources
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	582
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location Name	Baltic Sea
Coordinates	Lat. (^o)	59.51	Long. (^o)	23.13	Alt. (m)		Depth (m)	40
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026799	Metagenome / Metatranscriptome	196	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186481_10398321	F026799	N/A	SWLKSSFLLWLGPPARPFEPPSPALAAGQMGAAGSCCSCEDETGSFLEEGKRPRRESRKRHPNEFTIIIDRRSGEGLGIDASPEKTGTLEIKNITPAGLVDRWNKSLAEDSREIVKPGMRVIEVNGRYNSAMQLIAACRETEVLHITVIPPGDL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.