NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186655_1021395

Scaffold Ga0186655_1021395


Overview

Basic Information
Taxon OID3300017479 Open in IMG/M
Scaffold IDGa0186655_1021395 Open in IMG/M
Source Dataset NameMetatranscriptome of coastal eukaryotic communities from South Pacific Ocean in L1 medium, 22 C, 20 psu salinity and 668 ?mol photons light - Karlodinium veneficum CCMP 2283 (MMETSP1015)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1215
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NameSouth Pacific Ocean
CoordinatesLat. (o)-32.2167Long. (o)-80.7355Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018662Metatranscriptome233Y

Sequences

Protein IDFamilyRBSSequence
Ga0186655_10213951F018662N/AARNSRLCLAHPGFYHQLDNEAKETQPLMAHQLTIVLACVVLGVVHAVNEDSNGMLLDGQSVQNMARAFARSEKMHQASMLAISRSMSFEKSVEVLRHRSKLNPELAQITDMLEGHKHLRKQPKGYSGVDGARKLLNDMIFEAMSKYDQEIAKCTDYYSKQCAAMEVCRGQIAAANYIAANSRALILDAQANINRCEVDIPTRKYELKQHLLKCKAELYKLNTRLKIVMGDIAVMTMILEMTDCDKSLLQTQNMAMLQCRDPCTNKTFVTFDHKGLKQQVSKLKSEFANSLMQNTFSDLFEGVESLEMAEFLQTDSETDSEQMPIVNKTQFNNPPVPVTKVPPNPCTDPFAGAPSTNDKRAAKCTITKSPQCYKLQERFLLIQSGIQDERDELMEEISMLEHYCEE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.