NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181377_1003708

Scaffold Ga0181377_1003708


Overview

Basic Information
Taxon OID3300017706 Open in IMG/M
Scaffold IDGa0181377_1003708 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4348
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (93.75%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NameSubarctic Pacific Ocean
CoordinatesLat. (o)-29.499Long. (o)-71.609Alt. (m)Depth (m)12
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015151Metagenome / Metatranscriptome257Y
F022016Metagenome / Metatranscriptome216Y
F060786Metagenome / Metatranscriptome132N
F076507Metagenome / Metatranscriptome118Y

Sequences

Protein IDFamilyRBSSequence
Ga0181377_100370810F015151GAGGMITLKNGLIISADNDGFQSINHLTNKIDKGSFTKFTDLPDIFYKELFEDDRTLLTKIDNPELSTILQRTKQYGI
Ga0181377_100370811F022016AGGAMAFDMYKTHKLADHLESEAYDHCQWAISAFYDLELEENEYGYEQDVYEVLTKDQIEEIDAYISEHTAENMWHEPYSISCLNTIVDRWYEEHEGDD
Ga0181377_10037082F060786GGAGGMNTKYVLSQKTGEWIPIGPDDMDYTRYGKTLDELIEMRDAINKIVYGTKRFKT
Ga0181377_10037087F076507AGGTGGMSLILSIAEAKEKGMWRLVEQLERDLERRQLLKMAPLEDVKEKDVNKVWEEPDDWDDL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.