NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181404_1038779

Scaffold Ga0181404_1038779


Overview

Basic Information
Taxon OID3300017717 Open in IMG/M
Scaffold IDGa0181404_1038779 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1213
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000896Metagenome / Metatranscriptome845Y
F007531Metagenome / Metatranscriptome349Y
F019731Metagenome / Metatranscriptome228Y

Sequences

Protein IDFamilyRBSSequence
Ga0181404_10387791F000896N/AEPQVSEVLEIQRFREGRKTIMTNKINLVINLSILALLIYLSVAVKQIQDEVFPDPNIMIPMNMGYDNSAELRYNIQELLNNVLKDAINEQEKD
Ga0181404_10387792F019731AGGAGMDDIDNILSNIDLEEELIETEDNAKDWYCDDCEHGPMMDGDTHCSRCGAKHSYHQEEEMTGWEDEDIESEVEEIY
Ga0181404_10387794F007531AGGAGMDNKNTRKILLFIDGIGGINRQEMVHGTLYLKLDNDRDCDFIHTEIRKFYREFVNPEGGVNMYAVGDEFAFDFVPQDREAPVFSDEDYSGKEDMMPSDVDKGIWSEFAEEELMNNMPEDVDTMLDLMNDAKEGR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.