NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181381_1046008

Scaffold Ga0181381_1046008


Overview

Basic Information
Taxon OID3300017726 Open in IMG/M
Scaffold IDGa0181381_1046008 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)962
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021778Metagenome / Metatranscriptome217N
F044529Metagenome / Metatranscriptome154N

Sequences

Protein IDFamilyRBSSequence
Ga0181381_10460081F021778GGAGGMGMPKFLEDYVTVDTLISKMNNEYPECRLVAEMVDNGDDWVIFKSSFYENKEDTEPKATGYARQTKADHNSWFEMASTKANGRCLRVVFSESTTAEEMIGIAPSKDAAPKISIEKELEKAGIEYEDVSVSQTHIINNIKSFAMDVANENKANAANWYAQALGELDIPEAKLTIDNMKSVKNKLQDIATNLQKEGA
Ga0181381_10460082F044529GGAMLIQEIIYLGFVVYGVISLLMTMAYVSLKLDDKRLREKKKDLYDVTDFESRLKEGEILNWCNLFTGTHHFDAPADDGNFVCLKCWTYEGYEMEEV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.