NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181419_1013974

Scaffold Ga0181419_1013974


Overview

Basic Information
Taxon OID3300017728 Open in IMG/M
Scaffold IDGa0181419_1013974 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2315
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000613Metagenome / Metatranscriptome985Y
F002192Metagenome / Metatranscriptome585Y
F039704Metagenome / Metatranscriptome163Y

Sequences

Protein IDFamilyRBSSequence
Ga0181419_10139742F002192GAGMHQVLLYSTFFIAVLALFAGLYASGRVAKIQLGTKDLDWDAIANMTGDLATIKKTIQTLNNRINGMHSPKLQEQELMMQLLSKQGDKQNGKMIGG
Ga0181419_10139744F000613AGGAGMPLVKKRLSVAAGATSDQVLAGTTYEYVDPGTRIVVASAVDTAGTSTADTTMDFTVNNAEFSKNASVSALVTGEPFGWNGNYVMNDMVTTGQVRNRPIITFTNGTAATRTIDVAVFIGG
Ga0181419_10139745F039704N/ANISDEMLIQILLKRFRNDGPVVTKAALRKTKSTIRKLHSMQDVLKSITPTAAGRRRAPMKRAMSTTLIKN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.