NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181396_1004265

Scaffold Ga0181396_1004265


Overview

Basic Information
Taxon OID3300017729 Open in IMG/M
Scaffold IDGa0181396_1004265 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2938
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (90.91%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001655Metagenome / Metatranscriptome656Y
F002858Metagenome / Metatranscriptome525Y
F103165Metagenome101N

Sequences

Protein IDFamilyRBSSequence
Ga0181396_100426511F103165N/ACQITGKYFEDTLIAKTAVRVSDYPSEPSWGIYKTYDGAAILCDCDVDHAKGELNNDS
Ga0181396_10042654F001655GGAGGMKQPENGHTKHFGNDGPIGNDAEIIVYYEERGPAEPVLRIPFWYCKDELGLYENFEASVQRTAKALAESYTYWPDGYVHVQTIINQEYVNII
Ga0181396_10042655F002858AGGAGMLIDEKSIYVVDGGDYSIYCLGYTQARTVTNDIMKADPWGGIPFVLRKDLEFSLDDRGNVVMSKSTLDKILDLASDDLPEGDE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.