Basic Information | |
---|---|
Taxon OID | 3300017748 Open in IMG/M |
Scaffold ID | Ga0181393_1108061 Open in IMG/M |
Source Dataset Name | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 712 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 33.55 | Long. (o) | -118.4 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F078825 | Metagenome | 116 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0181393_11080611 | F078825 | N/A | ETRRNPNFVPIISSRGEGTGSGQAKFVPVMPNMDELMALPYMERINNDINASYGVMPIVTGSTAGVGGLNAEGEQISLFDRTVLETQQCLEMGFLKPLMKLMGIKTWKVMFADINVKNEQQALANMLQKANIITVLNKVGIEATLDKDGNLVLPDKPQVSMPEEAKPEVGALKP |
⦗Top⦘ |