NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187219_1018223

Scaffold Ga0187219_1018223


Overview

Basic Information
Taxon OID3300017751 Open in IMG/M
Scaffold IDGa0187219_1018223 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2600
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023856Metagenome / Metatranscriptome208Y
F056585Metagenome137N
F071124Metagenome / Metatranscriptome122N

Sequences

Protein IDFamilyRBSSequence
Ga0187219_10182233F023856GGAGGMRCRACDKILEDSELTRKYTHGNFLDLCGNCLSASANAGVDPDTMQYYQYEVFTDEDKCDTLY
Ga0187219_10182234F071124AGGMTYAEFELGYYMGDSEDDSGPPEDPETQAMLEHLIEYETEMFKLECRRRYSGCTYRQLRSLLINLHGEDWKNAL
Ga0187219_10182235F056585AGGAGGMTRETWEMWADEYQEYYEDETPVYPDDMEEFKKEEQKVIDEAIRAIQGLSA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.