NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181422_1000749

Scaffold Ga0181422_1000749


Overview

Basic Information
Taxon OID3300017762 Open in IMG/M
Scaffold IDGa0181422_1000749 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10616
Total Scaffold Genes25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)24 (96.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048209Metagenome / Metatranscriptome148Y
F088537Metagenome / Metatranscriptome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0181422_100074918F048209AGGAMDDLSTKPCNCGGTLGEVIGFQERSTDGVQVPYRVCWWCQDCDTTEKAVGRETHIEWGK
Ga0181422_100074925F088537AGGTGGMSTGPWEGGKGSRPRKYSVKKYLDNYERIFNASKQEEGQEGNQREHQDRDGSGKASQPGDSHSHV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.