NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187220_1020898

Scaffold Ga0187220_1020898


Overview

Basic Information
Taxon OID3300017768 Open in IMG/M
Scaffold IDGa0187220_1020898 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1969
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022311Metagenome215Y
F032077Metagenome181N

Sequences

Protein IDFamilyRBSSequence
Ga0187220_10208982F032077GGAMDSEETSIELKDRMRDALAPMLAMEQERTAKNSLANNNPQRWLAAASMFLAGSSMHDVKNELDMHHYIARRINGIVKTCDEARVFRQERAMQLASTIDEISSIGEKIASSYLDGSAEAEEKIKKAETKDLANLAVAQEKLHRTFDNVTGNNVQKIEVRHITTPEEAMSLIDSLPEAEVIDVGEDG
Ga0187220_10208983F022311AGGAGMAKSLIDESYDPIYDQVRGILGEHFENYCFIVMDEKGELFYDYNHLPAGRMLLHEMQLEIGDDNIEIEWEFESDPDDPEDDAVD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.