NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181346_1021779

Scaffold Ga0181346_1021779


Overview

Basic Information
Taxon OID3300017780 Open in IMG/M
Scaffold IDGa0181346_1021779 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2689
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)43.1881Long. (o)-86.344Alt. (m)Depth (m)15
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000903Metagenome / Metatranscriptome843Y
F001897Metagenome / Metatranscriptome620Y
F003182Metagenome / Metatranscriptome502Y
F009883Metagenome / Metatranscriptome311Y

Sequences

Protein IDFamilyRBSSequence
Ga0181346_10217794F003182AGGAGMHILLFDCSICSKLYGKPKQRHGLKKGAELTQHEWFAQCMSCGTFGIKIVDDARIGELCNGNL
Ga0181346_10217795F000903AGGAGGMIAAIQHCHDRSADHSSRIVKDISWFAYVAQMGESMAAEYVVAKHLGYDYTPGITWDKSKADVGDHIEVKWSANPASNLWIQESDRHDRDIAVLVTGSSPKMQIVGWMPVVIAKKPRYRNPSQNNWSVPQINLQPIETLQRSNYAHSVI
Ga0181346_10217797F001897N/AMATFMDGYEGNKERTDRWIATFPQGRLESHIVEFDFAKGYVLVQAKAWRNQEETEPAGIDYAHGFLTAYSSKMARWMIEDTCTSALMRVMALVMGGAEKATQEVMALVKSEAPAADYDYWTTKHGDVPSYQTAVEAEESGTPSFGSSEDAWVPNAVPSCSHGSMRWNQSKPDALKSWGGYFCSEKVKAMQCTPRWYVLRSTGNWEPQV
Ga0181346_10217798F009883GGAGMNEASIVIAMIIAGALWAVMAYSVGFKEGERQGYTRGRAVARHAVSAEKAVK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.