NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181380_1007012

Scaffold Ga0181380_1007012


Overview

Basic Information
Taxon OID3300017782 Open in IMG/M
Scaffold IDGa0181380_1007012 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4488
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (91.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028649Metagenome / Metatranscriptome191N
F049595Metagenome / Metatranscriptome146N
F106098Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0181380_100701210F028649AGGAGMKPAFIAHHRTVAKKMAYVWGMMIIATGTVGLAGYHCLFIDDMFAIVTGIGMISIASVGLPWSILGCLFSIQDSRG
Ga0181380_10070122F049595GGGGGMSHVSDYRFENHGSIWLCHPMNADAKDNLRQACDADDAPFNISWCDALVVDPRFVNDIAKQLTDEGWTVE
Ga0181380_10070127F106098GGAGMPDVYICMDGVPLWVELKIIKNNRVSVSKSQIAWHSAHNRCGGVSFFLLHDPCQGDLYLFDGGSALDLGASCVSDLRPASLYIGSMRDLIKALRSCGLAAWTGSFAA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.