NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0163161_10621502

Scaffold Ga0163161_10621502


Overview

Basic Information
Taxon OID3300017792 Open in IMG/M
Scaffold IDGa0163161_10621502 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)893
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018030Metagenome / Metatranscriptome237N
F020741Metagenome / Metatranscriptome222N
F058291Metagenome / Metatranscriptome135N

Sequences

Protein IDFamilyRBSSequence
Ga0163161_106215021F018030N/AALPPGAVRGSAVLKLRDLLWSPEVGIALAISPDNYLAFALRESRLALVDTSAWPDKTLSALWTILDDPALNAALGIPQDTTLNAPRRNYPWR
Ga0163161_106215022F020741N/AMSLLLLSALIAQPAMAQVGAFSQSQGGEARAKARGDGAQVECGPIGCRPLPPGCRQVRLGGRWLDNNGLQVICDRKRN
Ga0163161_106215023F058291N/APYEPGYTGHWEAEKRRKETREWLRQRERDIAAPSIVPDTPKTDAATSDRR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.