Basic Information | |
---|---|
Taxon OID | 3300017813 Open in IMG/M |
Scaffold ID | Ga0188953_16569 Open in IMG/M |
Source Dataset Name | Saline water viral communities from Saloum River inverse estuary, Senegal ? P2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | GATC-Biotech AG, Konstanz, Germany |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 681 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Saline Water → Archevir - Metagenome And Diversity Of Hyperhalophilic Archaeoviruses |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Saloum River, Senegal | |||||||
Coordinates | Lat. (o) | 14.0536 | Long. (o) | -16.2885 | Alt. (m) | Depth (m) | .5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F038152 | Metagenome | 166 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0188953_165694 | F038152 | GAGG | MSCNNVNTTGSTTPGSSDIDFFISVAKGDFTGYTNVSKFGNNPSVKSAGFETIWDGSNLYPWPTS |
⦗Top⦘ |