NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181565_10012072

Scaffold Ga0181565_10012072


Overview

Basic Information
Taxon OID3300017818 Open in IMG/M
Scaffold IDGa0181565_10012072 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6502
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (53.33%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010091Metagenome / Metatranscriptome308Y
F014085Metagenome / Metatranscriptome266Y
F022423Metagenome / Metatranscriptome214Y
F040134Metagenome / Metatranscriptome162Y

Sequences

Protein IDFamilyRBSSequence
Ga0181565_1001207211F014085AGAAGMESLSPIREEAMKRAGGRCEWAYCNDNKWLELAHIQGIGMGGNKKRKYDINNVAILCKWHHDIYDGRQSSGHSKAIRDLLKGFLKRESTIT
Ga0181565_100120722F010091N/AMNSMNIDDMLYEAENGKRSPILDRITEEAEPFWHGCEERVKSGRNIKPYVVSRLLKEQYGIKISESAVRNHFENLANLGSQYE
Ga0181565_100120724F040134N/AMNTMTNIDTKSSWELTGIEYSGLGDKPYFILTNINGECKLVPIEKGVHNLRSLLDLDKE
Ga0181565_100120726F022423N/AMQDLNFIVNTIQSMTASVQNKETLNKIIGTANQYAVTMKFPADKTTWSDKQLTKYFDMIERLVDMPVEYTQDEFDSLSIQEKLSAVGIESEDITPGLQDSSGVIGGIVNKMEQQNKYRDDLKCPYCGEMVYDNRNSKRSDKSPDFTCSTNDPAKCGGHSGKWRKSWWLDNSDIPEEWGIN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.