NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181565_10113846

Scaffold Ga0181565_10113846


Overview

Basic Information
Taxon OID3300017818 Open in IMG/M
Scaffold IDGa0181565_10113846 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1909
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (42.86%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024111Metagenome / Metatranscriptome207Y
F025731Metagenome / Metatranscriptome200Y
F027834Metagenome / Metatranscriptome193Y
F055727Metagenome / Metatranscriptome138Y

Sequences

Protein IDFamilyRBSSequence
Ga0181565_101138462F024111N/AMMSNPIFAFVFPFGEHGGEFRCKRNFVDAESAANWAVEIILKEGDDYCYFKEVASADYVFEPACESHTVVCWHDDAPTWEMYDVID
Ga0181565_101138463F025731N/AMPNSTNTQRKKAQMASALFNDVQLLGSVITCTEGFDLLSCDEQMRLEDLIGTGNV
Ga0181565_101138464F055727GGAMYNHFLEFTLDEMVDAYTYFTYIHDYEGCRLVADAFDQNVSLNLVNFEI
Ga0181565_101138465F027834N/AMKQLTFDDAMCFAYGRTMLTGGSSIGAMDNGEYYVPKYGYVVGGIVPEKSCDMDNESAFKHLYSRLLYQAELELNQSGSAVIGTWVEDGKIVFDLCNVLDDMKDALELGAKRGERAIYDLEEDREIFINHGA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.