NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181552_10001099

Scaffold Ga0181552_10001099


Overview

Basic Information
Taxon OID3300017824 Open in IMG/M
Scaffold IDGa0181552_10001099 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)20530
Total Scaffold Genes36 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (27.78%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005287Metagenome / Metatranscriptome406Y
F025258Metagenome / Metatranscriptome202Y
F034890Metagenome / Metatranscriptome173Y

Sequences

Protein IDFamilyRBSSequence
Ga0181552_100010991F025258N/APFTKELAEQMKVAMTEPFDEKRTLCNVLKLAYRCSREESYNLQAVQALLLESLWMGQRMHSKLYDTQKQEFDNEHQQQNEDEDPFAVDWSNLDGRNVAQGNWD
Ga0181552_100010996F005287GAGMTILSKNIVYSEHYYDECFEYKDGSGRVPDGLAVGYEIESNAPNRALILFDDITYSKYDHQYWDNYELENDIDRIVIP
Ga0181552_100010999F034890N/AMILIEDANEEKYHINPKQVIYVKERDHMGKKMWKIMMSNGEALMTSNEHGALCIIASIKSKRKIN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.