NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0189785_1499

Scaffold Ga0189785_1499


Overview

Basic Information
Taxon OID3300017826 Open in IMG/M
Scaffold IDGa0189785_1499 Open in IMG/M
Source Dataset NameSaline water viral communities from hypersaline Lake Retba, Senegal ? P6
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGATC-Biotech AG, Konstanz, Germany
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1204
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Saline Water → Archevir - Metagenome And Diversity Of Hyperhalophilic Archaeoviruses

Source Dataset Sampling Location
Location NameLake Retba, Senegal
CoordinatesLat. (o)14.8388Long. (o)-17.2341Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074460Metagenome119N

Sequences

Protein IDFamilyRBSSequence
Ga0189785_14993F074460AGGTGGMYYHCPHCRTWRSDTYVRIDPRTRIPQCEYCDEFVNGRLGDAAYKELLKKHALEVPPPGE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.