NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187849_1039816

Scaffold Ga0187849_1039816


Overview

Basic Information
Taxon OID3300017929 Open in IMG/M
Scaffold IDGa0187849_1039816 Open in IMG/M
Source Dataset NamePeatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2301
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019359Metagenome / Metatranscriptome230Y
F029005Metagenome / Metatranscriptome189Y
F046783Metagenome / Metatranscriptome150Y

Sequences

Protein IDFamilyRBSSequence
Ga0187849_10398161F046783GGAGGMKKWLCSVAGLSLALAGSLAALAQTPAVPPPNILDIETINIKPDMDGPYDKIASEYPELSEQLKDPTHVLGMEALTGSPRAIYLSGFDSFEAFQKSEEWLTGDAATDAK
Ga0187849_10398164F029005AGGAGMAGSTDSHIVELHTKAAYAHEAAAHVHSTGDHASAQELAKKALVYSVEAVKCTEEIAKSAPQPMQV
Ga0187849_10398165F019359GGAGGMDCPICGDLKRAYEAGFSEYIKASFSACYRVSKRLAARMNVDMERARHELKEHRFVCTSAIRVFALLPKQEASTSLRQLAA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.