NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187879_10000581

Scaffold Ga0187879_10000581


Overview

Basic Information
Taxon OID3300017946 Open in IMG/M
Scaffold IDGa0187879_10000581 Open in IMG/M
Source Dataset NamePeatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)24402
Total Scaffold Genes20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002626Metagenome / Metatranscriptome542Y
F038574Metagenome / Metatranscriptome165Y

Sequences

Protein IDFamilyRBSSequence
Ga0187879_100005811F002626N/ANQNYLLVVDSGSGDLAVIQKRTPKKKFEPSEYSLLTIIPVGMGPNQIVVKSFLATKLIEG
Ga0187879_1000058115F038574N/AVTIALVGLTQNLLFWPSSLLCGSIPTTDHILGARRKSHPKPTRCLMATFDQFPALVCKSCSRPIPLPPAKCPDTSEGQGLWPKGGSRRNFLCPACRHVHGYSAPDIQLMLPYTDPRRASTSYNVAYIRLQCEVQGCASIIRIRTLMAFNKCLDEEATAMLAASQAHAIACGNGHSLNGPIVHKSLAFDVHLDEDWETGDGWNRRAPARLSA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.