NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181607_10021529

Scaffold Ga0181607_10021529


Overview

Basic Information
Taxon OID3300017950 Open in IMG/M
Scaffold IDGa0181607_10021529 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4852
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (55.56%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008084Metagenome / Metatranscriptome339Y
F010653Metagenome / Metatranscriptome301Y
F043151Metagenome / Metatranscriptome157N

Sequences

Protein IDFamilyRBSSequence
Ga0181607_100215292F010653N/AMTVCAVAFHDNTFAVFDLREQLQWLQINLWELLHQLEYVEPHQRVIVYEEIQHIRSEIQRVVDQLIAHDRAQHPLP
Ga0181607_100215293F043151AGGAMIPYTAQENEYLSSGSYRKSNTNKQRKVKQEPDLRKHDWAIRTTIEVDGRTYVVPVQV
Ga0181607_100215299F008084N/AMTALIKKIGSYHSRFFAWLSMKAKTSKLWAVLLTLFVLYEIVEHTVWPILVPYLAYHHWFAN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.