NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181577_10187893

Scaffold Ga0181577_10187893


Overview

Basic Information
Taxon OID3300017951 Open in IMG/M
Scaffold IDGa0181577_10187893 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1387
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012719Metagenome / Metatranscriptome278Y
F027814Metagenome193N
F059019Metagenome / Metatranscriptome134N

Sequences

Protein IDFamilyRBSSequence
Ga0181577_101878932F059019AGGAGGMWKKVNEYITIIMATVGTLAMVGAVGSIESDMYLQGASMTLLGFASYVLALYSQMLYAED
Ga0181577_101878933F027814GGAGGMSDLKFNDLPKILKWIKEPSHSEHLFIIEQTLKSVKADQFKVGTKVSFGRENGMKRMGIIEKFGRVKAIVNCNGAKWRVPFDLMSVVTE
Ga0181577_101878934F012719GGTGGMDKYLKWVATAFLMIGVGANSLAIYPAGPLFTLAGGLTWLIVSIMWKEAALITTNLVLSAITIVGLVYTYIH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.