NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181580_10134578

Scaffold Ga0181580_10134578


Overview

Basic Information
Taxon OID3300017956 Open in IMG/M
Scaffold IDGa0181580_10134578 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1782
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000325Metagenome / Metatranscriptome1296Y
F021750Metagenome / Metatranscriptome217Y

Sequences

Protein IDFamilyRBSSequence
Ga0181580_101345781F000325GAGGMKTADGNDKLGKGCIVVSRPVGKTCPSSCDFLGNGCYAEATENQYKNAREAAFHNVITERGRIRSMILDAIKRGKSIRWHERGDWFIDGTLDTDYVDNVCAACESVIESGYTLPDMWFYTHVYDSRLVSKLGKFMSVYASVHNADDMVDAKNAGFDLFAWCDSDQKIATKRPRGKIKKAEWQAALPKLVVLSGETFVTCPEIRKGRTFVTCTGNKNSRACNMCVAGRKNVLFPCH
Ga0181580_101345782F021750GAGGMQLNSRTYVTLEDFVDAHKLDLYDVDNILLNSKYSYGTNDDTFVGYHTLCSMCGVRPLTSYSLELMVSLGS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.