NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187779_10000088

Scaffold Ga0187779_10000088


Overview

Basic Information
Taxon OID3300017959 Open in IMG/M
Scaffold IDGa0187779_10000088 Open in IMG/M
Source Dataset NameTropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)67774
Total Scaffold Genes84 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)70 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location NameColombia: Department of Meta
CoordinatesLat. (o)3.8381Long. (o)-73.3194Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007764Metagenome / Metatranscriptome345Y
F009829Metagenome / Metatranscriptome312Y
F026947Metagenome / Metatranscriptome196Y

Sequences

Protein IDFamilyRBSSequence
Ga0187779_1000008812F026947AGTAGGMTTSTANRNTSNTDDTILEAGDNHGVSNAAALYYPSLRGNCWDDELLPSGD
Ga0187779_1000008829F009829AGGAGMFARMLEFVPKMEKKEEFLKAVKNEVVPILKKQTGFVEILPFFPEVKTEKARFVSLWTERNHFERYEREWFPRVEEIMKPYLTTPITYQFYTLETALCEHFEKAVAA
Ga0187779_1000008870F007764N/AMAVTVEMHNTGDARLQRDVTAMIEHVLSGRLGDWRVVIVGSQGSDRWDMRVTGPHGFERSYPLEGALGQHEPSAVAAMVARMVPAKS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.