NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187781_10000148

Scaffold Ga0187781_10000148


Overview

Basic Information
Taxon OID3300017972 Open in IMG/M
Scaffold IDGa0187781_10000148 Open in IMG/M
Source Dataset NameTropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)47775
Total Scaffold Genes50 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)24 (48.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location NameColombia: Department of Meta
CoordinatesLat. (o)4.0627Long. (o)-73.195Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000725Metagenome / Metatranscriptome918Y
F000743Metagenome / Metatranscriptome910Y
F055598Metagenome / Metatranscriptome138Y

Sequences

Protein IDFamilyRBSSequence
Ga0187781_1000014813F000743N/AMTKDEKTRLSAVLRAAEYLFLENIALKLVLEHRQVANWQKLLDHLVADKEMLAGVRLKFSDLYREIEKSDDPSLVLETFIGGLPQPKKPH
Ga0187781_1000014818F000725GAGMLRALKTLRVVQWLLLVSILLYAVVGEVVAVGSRSANPKLDYLFTTTAVAVVGVIFLVRRTLVLRVEEILAAHPEDSLSLSHWRTGYIATYVLCESLALFGLVLRFLGGDFQQSLPFYIGGFTLLLFFRPRAPIGA
Ga0187781_1000014828F055598GGAGMKLFFLPGDLHLSKNASGFFVLTMCGRELVSTKSQRTALARFNAIRTELELKFPMREPTPEEKAELLQREINNSLLGHNSLGGRKKKSTAGGTRTFGG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.