 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300017973 Open in IMG/M |
| Scaffold ID | Ga0187780_10219736 Open in IMG/M |
| Source Dataset Name | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1327 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Colombia: Department of Meta | |||||||
| Coordinates | Lat. (o) | 3.8381 | Long. (o) | -73.3194 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F055833 | Metagenome / Metatranscriptome | 138 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0187780_102197361 | F055833 | AGGAGG | MVMGEKLWEGKGKSAGPGFIKHVGMEGVGQIYSWNAQLKGMGRAKGIDLNFNATGKSMTPPKGIGHAKTQGMFMTMSGDMGVFKGFDMMKMTGAKPGAVGLYSFMTTSEKLGWMNDLIALVTFEALDPMWNEMNITIHEWK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |