NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0180431_10222239

Scaffold Ga0180431_10222239


Overview

Basic Information
Taxon OID3300017987 Open in IMG/M
Scaffold IDGa0180431_10222239 Open in IMG/M
Source Dataset NameHypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1425
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment → Hypersaline Lake Sediment Archaeal Communities From The Salton Sea, California, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.4166Long. (o)-115.9166Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015086Metagenome / Metatranscriptome257N
F026163Metagenome199Y

Sequences

Protein IDFamilyRBSSequence
Ga0180431_102222391F015086N/ATQAESHKMVGKFAVGAEFDFAVDEVKYYPLVWLVPNGFTFNTEQKAVNYDFSMLVMDRQFESSSNTIEVLSDTAGIIIDIVTLLKRNVTDADFEIVVSGNAEPFFDSRTDVVAGHGISFSINTPYLESYCDIPT
Ga0180431_102222392F026163GAGMQLIKRLIPFVTCTLILLVALTPQRASCQFSDSTIREINERLIELHECRKKQELYIKLSKQDSAQIMNQAAIISNQEQTISQEKSKNKTLQKINAVQFALLVLALIL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.