NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0180434_10027239

Scaffold Ga0180434_10027239


Overview

Basic Information
Taxon OID3300017991 Open in IMG/M
Scaffold IDGa0180434_10027239 Open in IMG/M
Source Dataset NameHypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5446
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (81.82%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment → Hypersaline Lake Sediment Archaeal Communities From The Salton Sea, California, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.4166Long. (o)-115.9166Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008798Metagenome / Metatranscriptome328Y
F032642Metagenome179Y
F062721Metagenome / Metatranscriptome130N

Sequences

Protein IDFamilyRBSSequence
Ga0180434_1002723911F032642AGGAGGMKQPRPEVWRQVGTSTSYAGLVGALEVLEHHARRLCHEQPDNYLLDGLRNILCSIDELEAAGRFGTVVTEKRETAMAKHPSGKNRDLTNPLESPTTHPPAATQPPEATEGQGASR
Ga0180434_100272393F008798AGGCGGMATTMAEIYTRDELVALYPDGTVNVQVDDDVRPMTTDEWSEWIDGQVGQEKPADDPPA
Ga0180434_100272394F062721GGAGMNLTNPPKALIAMVAMIVIAVLMVADSIANEAGTGMLGTIVGYAVGNGIAARGGKDVQPIIGKKADV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.