NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187865_1000722

Scaffold Ga0187865_1000722


Overview

Basic Information
Taxon OID3300018004 Open in IMG/M
Scaffold IDGa0187865_1000722 Open in IMG/M
Source Dataset NamePeatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)43440
Total Scaffold Genes39 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)28 (71.79%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000359Metagenome / Metatranscriptome1236Y
F000372Metagenome / Metatranscriptome1220Y
F000985Metagenome / Metatranscriptome813Y
F012097Metagenome / Metatranscriptome283Y

Sequences

Protein IDFamilyRBSSequence
Ga0187865_100072215F000359GGAGMSGQVILYFDDQADALRFALAAGSVMAGEGTRATDDLVQETARVTRIRLDAANKEKGKQPNPPERVA
Ga0187865_100072221F000985AGGMKNVYEVLRQKELELTRLEKEVEALRVAAPLLSDEKEPLAEAPKPSLTATAPPQPVRIPPVVAAQGATAPARVAGWEEAAKRWP
Ga0187865_100072232F000372AGGAGVTGSGSGVARRWTVIASGLLLLALALVVIYTGPNAFLSPVALVVVAAIGLAALLLQVWFRRDFPNIHSPLWLNVLGIVCAMVALFADYFRMTRRALDLVAFAAVVCFGISGSLILHALRRRVRTPQSTGTE
Ga0187865_100072236F012097AGGGGGVNTLREFLAETPAAAEQPRVTPIREQVPRKVVSPAASVHDDQIHALVQQLFFRHESKPVRHVGFVTVEASTETATLCLEVARVLAEEGRYDVGLIDAHPDSIPLQTQLQISSASRAEATWLIAPRLWMVPRQSWLPDACGPRITDQNLSRLRELTTEFDFSILWCAPVSWLTTSIGQTCDGLVLVLAANKTRRLVAAQIKDQLSRAQVPLLGTVLAERRFPVPQGLYRSL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.