NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0184638_1093391

Scaffold Ga0184638_1093391


Overview

Basic Information
Taxon OID3300018052 Open in IMG/M
Scaffold IDGa0184638_1093391 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1104
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9195Long. (o)-106.9496Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013837Metagenome / Metatranscriptome268Y
F043689Metagenome / Metatranscriptome156Y
F050357Metagenome / Metatranscriptome145N

Sequences

Protein IDFamilyRBSSequence
Ga0184638_10933911F013837GAGMTTLMDTDRTEAPERPRSKPAAAVDARRDTATESRSLERSFEVASRGGYARTVVGRLAYFDEEAQTYMVLTRSGALVRVPLRDITSSRGVPRTGPIVADALSRMSRLRSVTTVSPT
Ga0184638_10933912F043689AGGAGGMTTLMDTVRIEAPTRSPVRPASPLDPSWDDGSDTPSSERSVQGRSRSTQWDPLAMGRGQSLSSEPA
Ga0184638_10933913F050357N/AEPVEGIRLWRASRQKLVGMVYLDKGVLDLDIQDDHERALVEDVLEQTGQVTWSFSRFDEGEWQENIAEPRTERWLWFVVANILYPMGYQADLGISEDGEPTTG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.