NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0184623_10039852

Scaffold Ga0184623_10039852


Overview

Basic Information
Taxon OID3300018056 Open in IMG/M
Scaffold IDGa0184623_10039852 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2133
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9195Long. (o)-106.9496Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003507Metagenome / Metatranscriptome482Y
F009760Metagenome / Metatranscriptome313Y
F014395Metagenome / Metatranscriptome263Y
F022502Metagenome / Metatranscriptome214Y

Sequences

Protein IDFamilyRBSSequence
Ga0184623_100398521F009760AGGAGMGLVRSLQHWLSGTGAPLHVADFVPDTHPIRQWADTFPWAALVAAIEQSFAQRVPQRSPRGRRPVPIRVLLALE
Ga0184623_100398522F003507GGAMYAGGLREYQAPRSQGHCVLPETLCECRGRIDEARMEALIAIQAAAAMEEGLVSPAHLVIDTFPCEQGSQRVTDATTL
Ga0184623_100398523F022502N/AMIARIAQRCSRRATQLQRHAHRLQQERKKVMRGFGRQCRGHGQVFVKLGRQTAQQLLALGNPIIALEQQAQQLLTQATALRDSTRERLADAFNAALSNHTHLRKQSTQLTHGKTLRHCQRINAYDLTLAPLRKGKRNCPAPCGRKPGIASEPATGFLFANRVPEGNPNDASAVGP
Ga0184623_100398524F014395GAGMLTVGIPKSVQPIAPHPSAEEVCAILNAAGFNRQRTPYQVQWACACGSSRPVVESHIASLRSRGAGQVRYTGHPGAVRQQGMTVMAHNGATLVRIRQQQLSKRAQKFRRLLGLRHRNTKEINNPKN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.