NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0184617_1001589

Scaffold Ga0184617_1001589


Overview

Basic Information
Taxon OID3300018066 Open in IMG/M
Scaffold IDGa0184617_1001589 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3365
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9195Long. (o)-106.9496Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005850Metagenome / Metatranscriptome388Y
F030704Metagenome / Metatranscriptome184Y
F097928Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
Ga0184617_10015893F097928AGGAGGMRQVEREQLIELGILTPDCDPRITTSQKVSPERKRNVRRWVKEREAMSGVLLTRILECLKRA
Ga0184617_10015896F030704GAGGMRSSDRLVGSASRQSVEQFYEARLVRIAHGGFAIWPDPIGMLDPQIVVNLLLELGVGVDLVIHDYWLGERFKCGAGGFPRRAWRNRRRAFVP
Ga0184617_10015897F005850AGAAGGMTKSTPTLSLTQSGLLAVLLQRQHYRVFQLARRRAHRKQMRAVLWSTLTWPFRALTARTLVDDSARPFVGTLPRHT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.